PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g047060.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 213aa    MW: 24645.2 Da    PI: 6.1721
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g047060.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM116.33.1e-36201391127
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGf F P+deel+v++L++k++  +++  +vi+++++++++PwdL+ k+ ++ ++wyf+s+r +      +++r+t++gyWk+ g d++
  Solyc10g047060.1.1  20 LPPGFWFCPSDEELIVHFLHRKISLLPFHP-DVIPDLHLHSYDPWDLDGKAMSGGNKWYFYSRRTH------ETTRITSNGYWKSLGVDET 103
                         79*************************999.99**************977778899******9977......5789*************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                         +ls+++++ g+kk  +fy g+ p+g+kt+W+m+ey+
  Solyc10g047060.1.1 104 ILSTSNHNLGMKKYYTFYMGQPPQGHKTNWLMQEYS 139
                         ***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-4515179IPR003441NAC domain
PROSITE profilePS5100541.83220180IPR003441NAC domain
PfamPF023657.0E-2021139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MGDNNNNNNN NNNNNNHVKL PPGFWFCPSD EELIVHFLHR KISLLPFHPD VIPDLHLHSY  60
DPWDLDGKAM SGGNKWYFYS RRTHETTRIT SNGYWKSLGV DETILSTSNH NLGMKKYYTF  120
YMGQPPQGHK TNWLMQEYSH ISHSSPSSSS SRRRRSESKI VCPLSFHDYS KWVICRVYES  180
NSCDSDENEL SCLDEVFLSL DDLDDDEISL PH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-361618216170NAC domain-containing protein 19
3swm_B1e-361618216170NAC domain-containing protein 19
3swm_C1e-361618216170NAC domain-containing protein 19
3swm_D1e-361618216170NAC domain-containing protein 19
3swp_A1e-361618216170NAC domain-containing protein 19
3swp_B1e-361618216170NAC domain-containing protein 19
3swp_C1e-361618216170NAC domain-containing protein 19
3swp_D1e-361618216170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004248807.21e-115PREDICTED: NAC transcription factor 25-like
SwissprotQ8GWK63e-69NC104_ARATH; NAC domain-containing protein 104
TrEMBLK4CZX11e-157K4CZX1_SOLLC; Uncharacterized protein
STRINGSolyc10g047060.1.11e-157(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37662447
Representative plantOGRP45101024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.13e-57xylem NAC domain 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]